site stats

Dbget search-swiss-prot

WebUniProtKB/Swiss-Prot is now the reviewed section of the UniProt Knowledgebase. The TrEMBL section UniProtKB mandatory for each UniProtKB entry (mainly, the amino acid sequence, protein name or description, taxonomic UniProtKB manual Annotations of a UniProtKB entry are structured into the following sections: Function Names & … Web(Swiss-Prot) 569,213. Unreviewed (TrEMBL) 245,871,724. Species Proteomes Protein sets for species with sequenced genomes from across the tree of life. Protein Clusters ... Search with a peptide sequence to find all UniProt proteins that contain exact matches. Need help? Find answers through our help center or get in touch.

DBGET search - UniProt - Genome

WebFUNCTION: This protein is an aporepressor. When complexed with L- CC tryptophan it binds the operator region of the trp operon (5'- CC ACTAGT-'3') and prevents the initiation of transcription. The complex CC also regulates trp repressor biosynthesis by binding to its regulatory CC region. {ECO:0000255 HAMAP-Rule:MF_00475}. WebJan 1, 2001 · SWISS-PROT is a curated protein sequence database which strives to provide a high level of annotations (such as the description of the function of a protein, structure of its domains, post-translational modifications, variants, etc.), a minimal level of redundancy and high level of integration with …. tasti on off https://jirehcharters.com

UniProt/SWISS-PROT: TET5C_MOUSE

WebSWISS-PROT(Hofmann et al., 1999) is a curated protein sequence databasemaintained by the Swiss Instituteof Bioinfornmatics and is a collaborative partner of EMBL. The database consists of SWISS-PROTand TrEMBL, which consists of entries in SWISS-PROT-like format derivedfrom the translation of all CDS in the... [Pg.222] WebDBGET search - SWISS-PROT. Database: SWISS-PROT. SWISS-PROT protein sequence database. Release 2024_01, Feb 23. Swiss Institute of Bioinformatics; European … WebUniProtKB/Swiss-Prot is the expertly curated component of UniProtKB (produced by the UniProt consortium). It contains hundreds of thousands of protein descriptions, including … tas tiny homes

UniProt/SWISS-PROT: PYRH_ANADF

Category:Major databases in bioinformatics - SlideShare

Tags:Dbget search-swiss-prot

Dbget search-swiss-prot

ScanProsite user manual - Expasy

WebSWISS-PROT establishes cross-references with a variety of databases databases, such as the protein tertiary structure library PDB, the human gene Mendelian genetic database (MIM), the protein type and the site … WebThe UniProt Knowledgebase is a central hub for the collection of functional information on proteins with accurate, consistent and rich annotation. It consists of: UniProtKB/Swiss …

Dbget search-swiss-prot

Did you know?

WebSWISS-PROT protein sequence database. Release 2024_05, Dec 22. Swiss Institute of Bioinformatics; European Bioinformatics Institute. 568,744 entries, 205,548,017 residues. TrEMBL protein sequence database. Release 2024_05, Dec 22. European Bioinformatics Institute; Swiss Institute of Bioinformatics. 229,580,745 entries, 80,779,997,943 residues. WebDBGET Search - GENES: DBGET LinkDB KEGG2; Database: GENES. KEGG Genes Database Release 106.0+/04-06, Apr 23 Kanehisa Laboratories 47,017,458 entries. …

WebThe large databases are: Swiss-Prot (high lev el of annotation), PIR (protein iden ti - cation resource). 1. 2 Shamir: Algorithms for Molecular Biology c T el Aviv Univ., F all '98 T ... (see DBGET help [24]). Pro vided access to 20 databases, one at a time. Ha ving more limited options, the DBGET is less recommended than the t w

Webgenome browser: aa seq: 718 aa aa seq db search mmfrdqvgvlagwfkgwneceqtvallsllkrvsqtqarflqlclehsladcaelhvler eanspgiinqwqqeskdkvislllthlpllkpgnldakveymkllpkilahsiehnqhie WebDT 06-DEC-2005, integrated into UniProtKB/Swiss-Prot. DT 02-JUN-2024, entry version 112. GN Name=dppC; OrderedLocusNames=b3542, JW3511; OS Escherichia coli (strain K12). OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; OC Enterobacteriaceae; Escherichia. OX NCBI_TaxID=83333; RN [1]

WebID LACB_BOVIN Reviewed; 178 AA. AC P02754; Q32P89; DT 21-JUL-1986, integrated into UniProtKB/Swiss-Prot. DT 01-AUG-1991, sequence version 3.

http://www1.biologie.uni-hamburg.de/b-online/ibc99/dbget/dbget.html tast investment pitchWebUniProtKB/Swiss-Prot is a manually annotated, non-redundant protein sequence database. It combines information extracted from scientific literature and biocurator -evaluated computational analysis. The aim of UniProtKB/Swiss-Prot is to provide all known relevant information about a particular protein. the business of preloved fashionWebReferences on DBGET/LinkDB. Basic Search. DBGET Links Diagram; IDEAS Interface; Individual Databases DNA: GenBank and EMBL Protein: SWISS-PROT, PIR, PRF and PDBSTR GenBank: nucleic acid sequence database EMBL: nucleic acid sequence database SWISS-PROT: protein sequence database PIR: protein sequence database … tasti per screenshot windows 11WebMay 1, 2013 · DBGET DBGET has three basic commands (or three basic modes in the Web version), bfind, bget, and blink, to search and extract database entries. bget – performs the retrieval of database entries … the business of the 21st century audio mp3WebJan 1, 1997 · SWISS-PROT is a curated protein sequence database which strives to provide a high level of annotations (such as the description of the function of a protein, structure … the business of theatrical designWebID PYRH_ANADF Reviewed; 249 AA. AC A7H724; DT 18-MAR-2008, integrated into UniProtKB/Swiss-Prot. DT 11-SEP-2007, sequence version 1. tast investor relationsWebJan 1, 2001 · Abstract. SWISS-PROT is a curated protein sequence database which strives to provide a high level of annotation (such as the description of the function of a protein, … the business of television pdf